PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009590049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 221aa    MW: 26264.6 Da    PI: 8.4421
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009590049.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.7e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT++Ed++lv +vk++G ++W+  a+  g++Rt+k+c++rw +yl
   XP_009590049.1  8 RGPWTEQEDLQLVFYVKLFGDRRWDFLAKVSGLKRTGKSCRLRWVNYL 55
                     89********************************************97 PP

2Myb_DNA-binding54.92e-1761106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
   XP_009590049.1  61 RGKMTPQEERLVLELHSKWGNR-WSRIARKIP-GRTDNEIKNYWRTHM 106
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.984355IPR017930Myb domain
SuperFamilySSF466891.72E-286102IPR009057Homeodomain-like
SMARTSM007177.3E-13757IPR001005SANT/Myb domain
PfamPF002493.0E-14855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-21962IPR009057Homeodomain-like
CDDcd001673.69E-81055No hitNo description
PROSITE profilePS5129427.43456110IPR017930Myb domain
SMARTSM007171.4E-1660108IPR001005SANT/Myb domain
PfamPF002497.7E-1661105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-2463109IPR009057Homeodomain-like
CDDcd001673.45E-1063106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MVQEEIRRGP WTEQEDLQLV FYVKLFGDRR WDFLAKVSGL KRTGKSCRLR WVNYLNPDLK  60
RGKMTPQEER LVLELHSKWG NRWSRIARKI PGRTDNEIKN YWRTHMRKKA QEQRKKATSI  120
SPSSSFSNCS SSSSITNEEN ERNFYDTGGI ELLQIEEQKK ANDQEQAGES TKVYSMDEIW  180
KDIELLEENE TINKPIMGSI SPLWDYCPDP MWKDFDWSNF R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-29111020128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590049.11e-164PREDICTED: transcription factor MYB48
RefseqXP_016455594.11e-164PREDICTED: transcription factor MYB48-like
SwissprotQ9LX823e-73MYB48_ARATH; Transcription factor MYB48
TrEMBLM1B9E21e-127M1B9E2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000401491e-127(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.14e-73myb domain protein 48